Cursor Set - TRON II

Log-in or register.

TRON II Cursors

TRON II
  • Published on December 24th 2010 by .
  • Released under the Release to Public Domain license.
4.8 out of 5 stars. (52 reviews) Log-in to add your review.

The revised version of the TRON cursor set. The graphics are much sharper looking and the colors that I used more closely resemble those used in the movie TRON Legacy. Sorry I was so late getting them out.

You may recolor them if you want to for yourself, but I do ask that you do not upload them as your own.

Please rate and comment!

Thanks, and enjoy!

(View in Firefox to see animations. Animated cursors may not be visible in some browsers.)


Tags: Sci-fi □ Multicolored Movie Triangular

Resources

by JDDellGuy

See also

Tron TeaserTron Cursors
by JDDellGuy20kA complete set of Tron-themed cursors that contains various glowing e...
Mad Mix TeaserMad Mix Cursors
by adrenochromedream877A mad mix of cursors
Comic TeaserComic Cursors
by adrenochromedream2608A set of comic related cursors
Colossal Fun TeaserColossal Fun Cursors
by adrenochromedream1719a huge lot of random cursors
That's So Random TeaserThat's So Random Cursors
by adrenochromedream2335a robust lot of random cursors
Simply Marvelous TeaserSimply Marvelous Cursors
by adrenochromedream13ka huge lot of Marvel cursors
The Mix TeaserThe Mix Cursors
by adrenochromedream780An ultra mix of random & fun cursors.
All Mixed Up II TeaserAll Mixed Up II Cursors
by adrenochromedream2230An ultra mix of trippy, fun & colorful cursors.

Recent reviews and comments

- show all comments
user icon ☞ó ͜つò☞ registered user on January 20th 2022

que hd ddc cdu swis fud ff deusds xsf vu shefcd sbxsb hcdhfbfx grb vfhc34hrbfd54ryhc4re cdcbdh hfbegfg2x34ecbfywe5b4d txg5h4bedf fhtxfwvtfdbgx3ehtdee f f gftgg v vgv g g g g g gcs xweb cv wg xbwcgsvesxgbhfsffbxhezcs exgevg cfewe bvc ecxfwexwtfe rx crt f crcr rf6 we cd cebs cc ce dec dc dce fder e rd ecd c ed ccfwv e fec vc 45webc5 46c 4f6ce 5rd64r 6 c6r r5cdc53wfr4erd56df 54fcb5gfde c5gdfe rcf 5 dfvsdg64dcfb gbhb gywf gbwyhfcb gtyfh 4efyh b3 yhvfb hbeyrf gvgu5y4hfg eydfgbvychfbfchegfdxvbw3fevdgegsdwqfaesdhftvytgfrelkle,dwsjwchfcesd9nwehbfucwnbeefdgxwawgedhsbycrfhdcsahfehdusbcwfgehdcs xgbcghbhdfciwbenxsdgbcsfdbcgwedhecshfudegbssehdcfhbsdhshcbfeghsgchdhbshd

que hd ddc cdu swis fud ff deusds xsf vu shefcd sbxsb hcdhfbfx grb vfhc34hrbfd54ryhc4re cdcbdh hfbegfg2x34ecbfywe5b4d txg5h4bedf fhtxfwvtfdbgx3ehtdee f f gftgg v vgv g g g g g gcs xweb cv wg xbwcgsvesxgbhfsffbxhezcs exgevg cfewe bvc ecxfwexwtfe rx crt f crcr rf6 we cd cebs cc ce dec dc dce fder e rd ecd c ed ccfwv e fec vc 45webc5 46c 4f6ce 5rd64r 6 c6r r5cdc53wfr4erd56df 54fcb5gfde c5gdfe rcf 5 dfvsdg64dcfb gbhb gywf gbwyhfcb gtyfh 4efyh b3 yhvfb hbeyrf gvgu5y4hfg eydfgbvychfbfchegfdxvbw3fevdgegsdwqfaesdhftvytgfrelkle,dwsjwchfcesd9nwehbfucwnbeefdgxwawgedhsbycrfhdcsahfehdusbcwfgehdcs xgbcghbhdfciwbenxsdgbcsfdbcgwedhecshfudegbssehdcfhbsdhshcbfeghsgchdhbshdque hd ddc cdu swis fud ff deusds xsf vu shefcd sbxsb hcdhfbfx grb vfhc34hrbfd54ryhc4re cdcbdh hfbegfg2x34ecbfywe5b4d txg5h4bedf fhtxfwvtfdbgx3ehtdee f f gftgg v vgv g g g g g gcs xweb cv wg xbwcgsvesxgbhfsffbxhezcs exgevg cfewe bvc ecxfwexwtfe rx crt f crcr rf6 we cd cebs cc ce dec dc dce fder e rd ecd c ed ccfwv e fec vc 45webc5 46c 4f6ce 5rd64r 6 c6r r5cdc53wfr4erd56df 54fcb5gfde c5gdfe rcf 5 dfvsdg64dcfb gbhb gywf gbwyhfcb gtyfh 4efyh b3 yhvfb hbeyrf gvgu5y4hfg eydfgbvychfbfchegfdxvbw3fevdgegsdwqfaesdhftvytgfrelkle,dwsjwchfcesd9nwehbfucwnbeefdgxwawgedhsbycrfhdcsahfehdusbcwfgehdcs xgbcghbhdfciwbenxsdgbcsfdbcgwedhecshfudegbssehdcfhbsdhshcbfeghsgchdhbshdque hd ddc cdu swis fud ff deusds xsf vu shefcd sbxsb hcdhfbfx grb vfhc34hrbfd54ryhc4re cdcbdh hfbegfg2x34ecbfywe5b4d txg5h4bedf fhtxfwvtfdbgx3ehtdee f f gftgg v vgv g g g g g gcs xweb cv wg xbwcgsvesxgbhfsffbxhezcs exgevg cfewe bvc ecxfwexwtfe rx crt f crcr rf6 we cd cebs cc ce dec dc dce fder e rd ecd c ed ccfwv e fec vc 45webc5 46c 4f6ce 5rd64r 6 c6r r5cdc53wfr4erd56df 54fcb5gfde c5gdfe rcf 5 dfvsdg64dcfb gbhb gywf gbwyhfcb gtyfh 4efyh b3 yhvfb hbeyrf gvgu5y4hfg eydfgbvychfbfchegfdxvbw3fevdgegsdwqfaesdhftvytgfrelkle,dwsjwchfcesd9nwehbfucwnbeefdgxwawgedhsbycrfhdcsahfehdusbcwfgehdcs xgbcghbhdfciwbenxsdgbcsfdbcgwedhecshfudegbssehdcfhbsdhshcbfeghsgchdhbshdque hd ddc cdu swis fud ff deusds xsf vu shefcd sbxsb hcdhfbfx grb vfhc34hrbfd54ryhc4re cdcbdh hfbegfg2x34ecbfywe5b4d txg5h4bedf fhtxfwvtfdbgx3ehtdee f f gftgg v vgv g g g g g gcs xweb cv wg xbwcgsvesxgbhfsffbxhezcs exgevg cfewe bvc ecxfwexwtfe rx crt f crcr rf6 we cd cebs cc ce dec dc dce fder e rd ecd c ed ccfwv e fec vc 45webc5 46c 4f6ce 5rd64r 6 c6r r5cdc53wfr4erd56df 54fcb5gfde c5gdfe rcf 5 dfvsdg64dcfb gbhb gywf gbwyhfcb gtyfh 4efyh b3 yhvfb hbeyrf gvgu5y4hfg eydfgbvychfbfchegfdxvbw3fevdgegsdwqfaesdhftvytgfrelkle,dwsjwchfcesd9nwehbfucwnbeefdgxwawgedhsbycrfhdcsahfehdusbcwfgehdcs xgbcghbhdfciwbenxsdgbcsfdbcgwedhecshfudegbssehdcfhbsdhshcbfeghsgchdhbshdque hd ddc cdu swis fud ff deusds xsf vu shefcd sbxsb hcdhfbfx grb vfhc34hrbfd54ryhc4re cdcbdh hfbegfg2x34ecbfywe5b4d txg5h4bedf fhtxfwvtfdbgx3ehtdee f f gftgg v vgv g g g g g gcs xweb cv wg xbwcgsvesxgbhfsffbxhezcs exgevg cfewe bvc ecxfwexwtfe rx crt f crcr rf6 we cd cebs cc ce dec dc dce fder e rd ecd c ed ccfwv e fec vc 45webc5 46c 4f6ce 5rd64r 6 c6r r5cdc53wfr4erd56df 54fcb5gfde c5gdfe rcf 5 dfvsdg64dcfb gbhb gywf gbwyhfcb gtyfh 4efyh b3 yhvfb hbeyrf gvgu5y4hfg eydfgbvychfbfchegfdxvbw3fevdgegsdwqfaesdhftvytgfrelkle,dwsjwchfcesd9nwehbfucwnbeefdgxwawgedhsbycrfhdcsahfehdusbcwfgehdcs xgbcghbhdfciwbenxsdgbcsfdbcgwedhecshfudegbssehdcfhbsdhshcbfeghsgchdhbshd

que hd ddc cdu swis fud ff deusds xsf vu shefcd sbxsb hcdhfbfx grb vfhc34hrbfd54ryhc4re cdcbdh hfbegfg2x34ecbfywe5b4d txg5h4bedf fhtxfwvtfdbgx3ehtdee f f gftgg v vgv g g g g g gcs xweb cv wg xbwcgsvesxgbhfsffbxhezcs exgevg cfewe bvc ecxfwexwtfe rx crt f crcr rf6 we cd cebs cc ce dec dc dce fder e rd ecd c ed ccfwv e fec vc 45webc5 46c 4f6ce 5rd64r 6 c6r r5cdc53wfr4erd56df 54fcb5gfde c5gdfe rcf 5 dfvsdg64dcfb gbhb gywf gbwyhfcb gtyfh 4efyh b3 yhvfb hbeyrf gvgu5y4hfg eydfgbvychfbfchegfdxvbw3fevdgegsdwqfaesdhftvytgfrelkle,dwsjwchfcesd9nwehbfucwnbeefdgxwawgedhsbycrfhdcsahfehdusbcwfgehdcs xgbcghbhdfciwbenxsdgbcsfdbcgwedhecshfudegbssehdcfhbsdhshcbfeghsgchdhbshdque hd ddc cdu swis fud ff deusds xsf vu shefcd sbxsb hcdhfbfx grb vfhc34hrbfd54ryhc4re cdcbdh hfbegfg2x34ecbfywe5b4d txg5h4bedf fhtxfwvtfdbgx3ehtdee f f gftgg v vgv g g g g g gcs xweb cv wg xbwcgsvesxgbhfsffbxhezcs exgevg cfewe bvc ecxfwexwtfe rx crt f crcr rf6 we cd cebs cc ce dec dc dce fder e rd ecd c ed ccfwv e fec vc 45webc5 46c 4f6ce 5rd64r 6 c6r r5cdc53wfr4erd56df 54fcb5gfde c5gdfe rcf 5 dfvsdg64dcfb gbhb gywf gbwyhfcb gtyfh 4efyh b3 yhvfb hbeyrf gvgu5y4hfg eydfgbvychfbfchegfdxvbw3fevdgegsdwqfaesdhftvytgfrelkle,dwsjwchfcesd9nwehbfucwnbeefdgxwawgedhsbycrfhdcsahfehdusbcwfgehdcs xgbcghbhdfciwbenxsdgbcsfdbcgwedhecshfudegbssehdcfhbsdhshcbfeghsgchdhbshdque hd ddc cdu swis fud ff deusds xsf vu shefcd sbxsb hcdhfbfx grb vfhc34hrbfd54ryhc4re cdcbdh hfbegfg2x34ecbfywe5b4d txg5h4bedf fhtxfwvtfdbgx3ehtdee f f gftgg v vgv g g g g g gcs xweb cv wg xbwcgsvesxgbhfsffbxhezcs exgevg cfewe bvc ecxfwexwtfe rx crt f crcr rf6 we cd cebs cc ce dec dc dce fder e rd ecd c ed ccfwv e fec vc 45webc5 46c 4f6ce 5rd64r 6 c6r r5cdc53wfr4erd56df 54fcb5gfde c5gdfe rcf 5 dfvsdg64dcfb gbhb gywf gbwyhfcb gtyfh 4efyh b3 yhvfb hbeyrf gvgu5y4hfg eydfgbvychfbfchegfdxvbw3fevdgegsdwqfaesdhftvytgfrelkle,dwsjwchfcesd9nwehbfucwnbeefdgxwawgedhsbycrfhdcsahfehdusbcwfgehdcs xgbcghbhdfciwbenxsdgbcsfdbcgwedhecshfudegbssehdcfhbsdhshcbfeghsgchdhbshdque hd ddc cdu swis fud ff deusds xsf vu shefcd sbxsb hcdhfbfx grb vfhc34hrbfd54ryhc4re cdcbdh hfbegfg2x34ecbfywe5b4d txg5h4bedf fhtxfwvtfdbgx3ehtdee f f gftgg v vgv g g g g g gcs xweb cv wg xbwcgsvesxgbhfsffbxhezcs exgevg cfewe bvc ecxfwexwtfe rx crt f crcr rf6 we cd cebs cc ce dec dc dce fder e rd ecd c ed ccfwv e fec vc 45webc5 46c 4f6ce 5rd64r 6 c6r r5cdc53wfr4erd56df 54fcb5gfde c5gdfe rcf 5 dfvsdg64dcfb gbhb gywf gbwyhfcb gtyfh 4efyh b3 yhvfb hbeyrf gvgu5y4hfg eydfgbvychfbfchegfdxvbw3fevdgegsdwqfaesdhftvytgfrelkle,dwsjwchfcesd9nwehbfucwnbeefdgxwawgedhsbycrfhdcsahfehdusbcwfgehdcs xgbcghbhdfciwbenxsdgbcsfdbcgwedhecshfudegbssehdcfhbsdhshcbfeghsgchdhbshdque hd ddc cdu swis fud ff deusds xsf vu shefcd sbxsb hcdhfbfx grb vfhc34hrbfd54ryhc4re cdcbdh hfbegfg2x34ecbfywe5b4d txg5h4bedf fhtxfwvtfdbgx3ehtdee f f gftgg v vgv g g g g g gcs xweb cv wg xbwcgsvesxgbhfsffbxhezcs exgevg cfewe bvc ecxfwexwtfe rx crt f crcr rf6 we cd cebs cc ce dec dc dce fder e rd ecd c ed ccfwv e fec vc 45webc5 46c 4f6ce 5rd64r 6 c6r r5cdc53wfr4erd56df 54fcb5gfde c5gdfe rcf 5 dfvsdg64dcfb gbhb gywf gbwyhfcb gtyfh 4efyh b3 yhvfb hbeyrf gvgu5y4hfg eydfgbvychfbfchegfdxvbw3fevdgegsdwqfaesdhftvytgfrelkle,dwsjwchfcesd9nwehbfucwnbeefdgxwawgedhsbycrfhdcsahfehdusbcwfgehdcs xgbcghbhdfciwbenxsdgbcsfdbcgwedhecshfudegbssehdcfhbsdhshcbfeghsgchdhbshdque hd ddc cdu swis fud ff deusds xsf vu shefcd sbxsb hcdhfbfx grb vfhc34hrbfd54ryhc4re cdcbdh hfbegfg2x34ecbfywe5b4d txg5h4bedf fhtxfwvtfdbgx3ehtdee f f gftgg v vgv g g g g g gcs xweb cv wg xbwcgsvesxgbhfsffbxhezcs exgevg cfewe bvc ecxfwexwtfe rx crt f crcr rf6 we cd cebs cc ce dec dc dce fder e rd ecd c ed ccfwv e fec vc 45webc5 46c 4f6ce 5rd64r 6 c6r r5cdc53wfr4erd56df 54fcb5gfde c5gdfe rcf 5 dfvsdg64dcfb gbhb gywf gbwyhfcb gtyfh 4efyh b3 yhvfb hbeyrf gvgu5y4hfg eydfgbvychfbfchegfdxvbw3fevdgegsdwqfaesdhftvytgfrelkle,dwsjwchfcesd9nwehbfucwnbeefdgxwawgedhsbycrfhdcsahfehdusbcwfgehdcs xgbcghbhdfciwbenxsdgbcsfdbcgwedhecshfudegbssehdcfhbsdhshcbfeghsgchdhbshdque hd ddc cdu swis fud ff deusds xsf vu shefcd sbxsb hcdhfbfx grb vfhc34hrbfd54ryhc4re cdcbdh hfbegfg2x34ecbfywe5b4d txg5h4bedf fhtxfwvtfdbgx3ehtdee f f gftgg v vgv g g g g g gcs xweb cv wg xbwcgsvesxgbhfsffbxhezcs exgevg cfewe bvc ecxfwexwtfe rx crt f crcr rf6 we cd cebs cc ce dec dc dce fder e rd ecd c ed ccfwv e fec vc 45webc5 46c 4f6ce 5rd64r 6 c6r r5cdc53wfr4erd56df 54fcb5gfde c5gdfe rcf 5 dfvsdg64dcfb gbhb gywf gbwyhfcb gtyfh 4efyh b3 yhvfb hbeyrf gvgu5y4hfg eydfgbvychfbfchegfdxvbw3fevdgegsdwqfaesdhftvytgfrelkle,dwsjwchfcesd9nwehbfucwnbeefdgxwawgedhsbycrfhdcsahfehdusbcwfgehdcs xgbcghbhdfciwbenxsdgbcsfdbcgwedhecshfudegbssehdcfhbsdhshcbfeghsgchdhbshdque hd ddc cdu swis fud ff deusds xsf vu shefcd sbxsb hcdhfbfx grb vfhc34hrbfd54ryhc4re cdcbdh hfbegfg2x34ecbfywe5b4d txg5h4bedf fhtxfwvtfdbgx3ehtdee f f gftgg v vgv g g g g g gcs xweb cv wg xbwcgsvesxgbhfsffbxhezcs exgevg cfewe bvc ecxfwexwtfe rx crt f crcr rf6 we cd cebs cc ce dec dc dce fder e rd ecd c ed ccfwv e fec vc 45webc5 46c 4f6ce 5rd64r 6 c6r r5cdc53wfr4erd56df 54fcb5gfde c5gdfe rcf 5 dfvsdg64dcfb gbhb gywf gbwyhfcb gtyfh 4efyh b3 yhvfb hbeyrf gvgu5y4hfg eydfgbvychfbfchegfdxvbw3fevdgegsdwqfaesdhftvytgfrelkle,dwsjwchfcesd9nwehbfucwnbeefdgxwawgedhsbycrfhdcsahfehdusbcwfgehdcs xgbcghbhdfciwbenxsdgbcsfdbcgwedhecshfudegbssehdcfhbsdhshcbfeghsgchdhbshdque hd ddc cdu swis fud ff deusds xsf vu shefcd sbxsb hcdhfbfx grb vfhc34hrbfd54ryhc4re cdcbdh hfbegfg2x34ecbfywe5b4d txg5h4bedf fhtxfwvtfdbgx3ehtdee f f gftgg v vgv g g g g g gcs xweb cv wg xbwcgsvesxgbhfsffbxhezcs exgevg cfewe bvc ecxfwexwtfe rx crt f crcr rf6 we cd cebs cc ce dec dc dce fder e rd ecd c ed ccfwv e fec vc 45webc5 46c 4f6ce 5rd64r 6 c6r r5cdc53wfr4erd56df 54fcb5gfde c5gdfe rcf 5 dfvsdg64dcfb gbhb gywf gbwyhfcb gtyfh 4efyh b3 yhvfb hbeyrf gvgu5y4hfg eydfgbvychfbfchegfdxvbw3fevdgegsdwqfaesdhftvytgfrelkle,dwsjwchfcesd9nwehbfucwnbeefdgxwawgedhsbycrfhdcsahfehdusbcwfgehdcs xgbcghbhdfciwbenxsdgbcsfdbcgwedhecshfudegbssehdcfhbsdhshcbfeghsgchdhbshdque hd ddc cdu swis fud ff deusds xsf vu shefcd sbxsb hcdhfbfx grb vfhc34hrbfd54ryhc4re cdcbdh hfbegfg2x34ecbfywe5b4d txg5h4bedf fhtxfwvtfdbgx3ehtdee f f gftgg v vgv g g g g g gcs xweb cv wg xbwcgsvesxgbhfsffbxhezcs exgevg cfewe bvc ecxfwexwtfe rx crt f crcr rf6 we cd cebs cc ce dec dc dce fder e rd ecd c ed ccfwv e fec vc 45webc5 46c 4f6ce 5rd64r 6 c6r r5cdc53wfr4erd56df 54fcb5gfde c5gdfe rcf 5 dfvsdg64dcfb gbhb gywf gbwyhfcb gtyfh 4efyh b3 yhvfb hbeyrf gvgu5y4hfg eydfgbvychfbfchegfdxvbw3fevdgegsdwqfaesdhftvytgfrelkle,dwsjwchfcesd9nwehbfucwnbeefdgxwawgedhsbycrfhdcsahfehdusbcwfgehdcs xgbcghbhdfciwbenxsdgbcsfdbcgwedhecshfudegbssehdcfhbsdhshcbfeghsgchdhbshdque hd ddc cdu swis fud ff deusds xsf vu shefcd sbxsb hcdhfbfx grb vfhc34hrbfd54ryhc4re cdcbdh hfbegfg2x34ecbfywe5b4d txg5h4bedf fhtxfwvtfdbgx3ehtdee f f gftgg v vgv g g g g g gcs xweb cv wg xbwcgsvesxgbhfsffbxhezcs exgevg cfewe bvc ecxfwexwtfe rx crt f crcr rf6 we cd cebs cc ce dec dc dce fder e rd ecd c ed ccfwv e fec vc 45webc5 46c 4f6ce 5rd64r 6 c6r r5cdc53wfr4erd56df 54fcb5gfde c5gdfe rcf 5 dfvsdg64dcfb gbhb gywf gbwyhfcb gtyfh 4efyh b3 yhvfb hbeyrf gvgu5y4hfg eydfgbvychfbfchegfdxvbw3fevdgegsdwqfaesdhftvytgfrelkle,dwsjwchfcesd9nwehbfucwnbeefdgxwawgedhsbycrfhdcsahfehdusbcwfgehdcs xgbcghbhdfciwbenxsdgbcsfdbcgwedhecshfudegbssehdcfhbsdhshcbfeghsgchdhbshdque hd ddc cdu swis fud ff deusds xsf vu shefcd sbxsb hcdhfbfx grb vfhc34hrbfd54ryhc4re cdcbdh hfbegfg2x34ecbfywe5b4d txg5h4bedf fhtxfwvtfdbgx3ehtdee f f gftgg v vgv g g g g g gcs xweb cv wg xbwcgsvesxgbhfsffbxhezcs exgevg cfewe bvc ecxfwexwtfe rx crt f crcr rf6 we cd cebs cc ce dec dc dce fder e rd ecd c ed ccfwv e fec vc 45webc5 46c 4f6ce 5rd64r 6 c6r r5cdc53wfr4erd56df 54fcb5gfde c5gdfe rcf 5 dfvsdg64dcfb gbhb gywf gbwyhfcb gtyfh 4efyh b3 yhvfb hbeyrf gvgu5y4hfg eydfgbvychfbfchegfdxvbw3fevdgegsdwqfaesdhftvytgfrelkle,dwsjwchfcesd9nwehbfucwnbeefdgxwawgedhsbycrfhdcsahfehdusbcwfgehdcs xgbcghbhdfciwbenxsdgbcsfdbcgwedhecshfudegbssehdcfhbsdhshcbfeghsgchdhbshdque hd ddc cdu swis fud ff deusds xsf vu shefcd sbxsb hcdhfbfx grb vfhc34hrbfd54ryhc4re cdcbdh hfbegfg2x34ecbfywe5b4d txg5h4bedf fhtxfwvtfdbgx3ehtdee f f gftgg v vgv g g g g g gcs xweb cv wg xbwcgsvesxgbhfsffbxhezcs exgevg cfewe bvc ecxfwexwtfe rx crt f crcr rf6 we cd cebs cc ce dec dc dce fder e rd ecd c ed ccfwv e fec vc 45webc5 46c 4f6ce 5rd64r 6 c6r r5cdc53wfr4erd56df 54fcb5gfde c5gdfe rcf 5 dfvsdg64dcfb gbhb gywf gbwyhfcb gtyfh 4efyh b3 yhvfb hbeyrf gvgu5y4hfg eydfgbvychfbfchegfdxvbw3fevdgegsdwqfaesdhftvytgfrelkle,dwsjwchfcesd9nwehbfucwnbeefdgxwawgedhsbycrfhdcsahfehdusbcwfgehdcs xgbcghbhdfciwbenxsdgbcsfdbcgwedhecshfudegbssehdcfhbsdhshcbfeghsgchdhbshd

user icon Anonymous on January 27th 2022

this cursor is sooooo good :-D ;-)

user icon PlayersOnes registered user on January 27th 2022

4.5 out of 5 stars.

Ok this cursor not is soo bad, but he is good to my friend (sorry but he dont have a account) and i like this cursor, thx for the creator 8-)

user icon Anonymous on March 31st 2022

i like this but i like balls more

user icon Anonymous on March 31st 2022

ehat the hell josh :-D

user icon Anonymous on April 24th 2022

<html>

<body>
 <p>

Ur mom. Good!!

 </p>
</body>

</html>

I'm the last anonymus nd i've to say i like big big pepenis :-)

fensuaphfuisoa,mhun igf ysaf,m gyfa8sf,mg ysa8fm gysafmga

que

er pepeeeeeeeeeeeeeeeeeeeeeeeee

Er peeeeeeeepeeeeeeeeeeeeeeeeee

no entiendo estoooooooooooooooooooooooooooooo oooooooooooooooo ooooooooooooooooooo oo oo oooooooooo

user icon Anonymous on August 12th 2022

IS THE BEAST ONE 8-) 8-) 8-)

user icon SomeoneWhooAsked registered user on September 8th 2022

4.5 out of 5 stars.

I am gonna try it out! I already have the original one, this set is very cool! 8-)

user icon Anonymous on April 12th 2023

awesome cursor brodi

user icon Lomgmi13 registered user on April 30th 2023

5 out of 5 stars.

8-) 8-) 8-) this is the best cursor in my opinion :-D :-D

user icon Anonymous